PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678447657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YA
Protein Properties Length: 236aa    MW: 25879.7 Da    PI: 9.1518
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678447657genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.81.8e-33111167158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                d p+YVNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh+hAl+R RgsgGrF
  678447657 111 DGPIYVNAKQYHGILRRRQTRAKLEAQNKL-VKTRKPYLHESRHQHALNRVRGSGGRF 167
                57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-37109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.201110170IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-24113135IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-28113167IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860115135IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-24144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEKTTSQDQC GSSDSGTNSS CYAVSTRFFI ELGCCGKHGQ DIRGAFFLGN PEMFTNASSA  60
EINQPMFQHS YSDPHFSGVF AAAYGHHSVI QPHMMGAAFG RVPLPPDLPE DGPIYVNAKQ  120
YHGILRRRQT RAKLEAQNKL VKTRKPYLHE SRHQHALNRV RGSGGRFLST KKQQQQSESA  180
DTLASTSSSP TPHDFLFDHK ASLKEPNNYC EGGGAQGGSS GPIYNGNRHY ASSTVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-22111173264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093783.14e-79PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_011093784.14e-79PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
SwissprotQ93ZH28e-43NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A022QE291e-76A0A022QE29_ERYGU; Uncharacterized protein
STRINGVIT_11s0016g01480.t011e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.19e-44nuclear factor Y, subunit A3